✨Mini Review #WardahMineral Clarifying Clay Mask
Brand sejuta umat lha ya ini mah. Walaupun aku punya kulit kering, tp belakangan ini suka banget beli clay mask karena ngebersihin kotorannya tuh bener2 ke dalem. Toh sesekali pakai clay mask engga akan bikin kulit aku makin kering kok, asal diimbangi dgn hydrating toner dan masker yg hydrating. ⠀⠀
Masker ini mirah harganya di bawah 20k tapi bisa dipake berkali-kali. Berikut review singkat dari aku mengenai masker dari @wardahbeauty
⠀⠀
Love:
- teskturnya creamy, halus mudah dibaur
- pas proses mengering engga bikin wajah ketarik👌
- gampang banget dibersihkan
- bikin wajah halus😭 ga ngerti lagi, halusnya tuh enak bukan yang narik gitu
- harganya super terjangkau
- untuk kulit berminyak ini good deal bgt aih soalnya dia narik minyak berlebih tp ga bikin ketarik nyiksa🤩
⠀⠀
Tapi, tentunya ada minusnya dr produk ini:
- engga ada seal apapun di lubang produknya, jadi engga tau itu kapan pertama kali dibuka:”)
- wangi alkoholnya strong sekali
- alkoholnya nusuk mata jd aku nangis(?) kalau make masker terlalu deket
⠀⠀
Kesimpulan:
Menurutku, produk ini cukup dan patut dicoba khusunya kamu yang kulitnya berminyak. Soalnya bener bener ngebersihin wajah dan jadi sehalus itu, kalau kalian timpa sheet mask setelahnya lebih enak. Tapi, kalau wajah kalian sensitif khusunya sama alkohol, mending mundur teratur hehe
⠀⠀
Harga: 16-19.000
⠀⠀
Rate: ⭐️⭐️ (2,5/5)

Untuk lebih lengkapnya kalian bisa lihat blog aku ya🌸
⠀⠀ #ClozetteID #beauty #skincare #makeup #beautybloggerindonesia #indobeautysquad #beautybloggerceriaid #beautiesquad #indobeautygram #beautyblogger #wardah #wardahbeauty #maskerwardah #wardahmineralclarifyingclaymask #wardahclaymask  #ipreview via @preview.app

✨Mini Review #WardahMineral Clarifying Clay Mask Brand sejuta umat lha ya ini mah. Walaupun aku... more

✨Mini Review #WardahMineral Clarifying Clay Mask Brand sejuta umat lha ya ini mah. Walaupun aku... more
Lagi suka ama #Dflorakosmetik iniii 🥰🥰😘👍🏻⁣
⁣
CC Creamnya ringan, tp coverage-nya beneran ada. Pas nyoba shade ivory ini, aku pikir bakal terlalu putih di kulitku. Ternyata nggak tuh. Bagus malah, kesannya jd lebih cerah. Finishnya nggak terlalu dewy, tp ttp ada glowingnya. ⁣
⁣
Buat yg kulitnya berminyak bgt, disaranin pakai loose powdernya. Lumayan bantu untuk kontrol minyak jg kalau buat aku. ⁣
⁣
Yg aku kurang suka tuh malah ama lipstiknya sih 😌. Lebih pas buat dibilang lipbalm aja ketimbang lipstick. Soalnya emang ga tahan lama. Males aja gt kalo kudu touch up mlulu. Malahan lebih bagus kalo dipake buat eye shadow ama blush on sih, soalnya ada efek glowing nya gt. Bikin muka kliatan seger 😍😍💖⁣
⁣
Review komplitnya udah kutulis di ibusegalatau.com ya. Mampir ya😉🥰 ⁣
⁣
#minireview #Dflorakosmetik #flawlessmakeup #makeupflawless #loosepowder #ccream #klinkindonesia #kosmetikhalal  #beautycare #beautytips #beautyblog #beautygram #beautybloggers #beautygirl #beautyaddict #beautycommunity  #beautymakeup ⁣#ClozetteID

Lagi suka ama #Dflorakosmetik iniii 🥰🥰😘👍🏻⁣ ⁣ CC Creamnya ringan, tp coverage-nya... more

Lagi suka ama #Dflorakosmetik iniii 🥰🥰😘👍🏻⁣ ⁣ CC Creamnya ringan, tp coverage-nya... more
Like Us
Hi guys! 
Siap-siap kena racun baru ya! Aku happy bgt nemuin brand makeup yang bagus tp affordable!! Ini dia one brand makeup tutorial pakai Regazza @priskilaid 💗 Aku tau makeup ini waktu nonton video nya omay @farida.nurhan ! Sekalian aku jg mau ikutan #faridamakeupchallenge nih.. btw anyway busway, berikut produk yg aku pakai sekaligus mini review nya 
1. Regazza Cream Foundation 02 : packagingnya unik bgt mirip cushion padahal ini cream foundation. coverage nya gokil! Di video ini aku sama sekali ga pakai concealer lihatlah dosa-dosa di wajah tersamarkan!

2. Regazza powder foundation 02 : bedaknya juga full coverage tp ringan bgt dipakai dan halus.

3. Regazza eyebrow pencil 02 : sumpah ini fav aku banget! Pigmented dan gampang diapply nya. Sesuka itu mana harga nya murah.

4. Regazza eyeshadow 01 : warna-warna nya natural bgt cocok dipakai sehari-hari dan banyak shimmer nya.

5. Regazza beauty color lipstick no 5 : warna nya cantik bgt dan pigmented. Finishnya satin cocok untuk pemakaian sehari-hari yg ringan. .
.
.

#motd #makeup #lidyamakeup #beauty #indobeautysquad #beautyenthusiast #makeuptutorial #makeupvideos #videomakeup #clozetteid #makeupoftheday #Lidyareview #regazza

Hi guys! Siap-siap kena racun baru ya! Aku happy bgt nemuin brand makeup yang bagus tp... more

Hi guys! Siap-siap kena racun baru ya! Aku happy bgt nemuin brand makeup yang bagus tp... more
KAWAII AUTUMN MAKEUP (PART. II)'And all at once, Summer collapsed into fall' 🍂🍁. Hello Autumn, long time no see! My favourite month of the year, daun warna-warni, style fashion kece yg didominasi oleh warm-tone, sprti pemilihan warna makeup inspiration kali ini yg jg didominasi oleh wrn brown-orange..First of all thankiss @kumurabeauty for the sweetest products to create this makeup look 💕 Let me write down a mini review about these products :.🍂 Lipsmacker Lipbalm - Dgn aroma icecream. Gemes bgt sm packagingnya! (Tips : sebelum pakai lipstick, aplikasikan lipbalm terlebih dahulu supaya bibir lembab. Biarkan beberapa saat br kemudian memakai lipproducts lainnya)..🍁 Beauty Creations The Sweetest Palette - This is the sweetest! Packagingnya lucu parah dgn gbr berbagai macam cake, candy. Warna2 eyeshadow palette ini didominasi oleh warna warm, mulai dari soft brown hingga dark brown, matte dan jg shimmer. Perfect for autumn-makeup! Nama masing2 shadenya jg unik dgn nama makanan seperti : Candy Apple, Jelly Bean, etc... 🍂 City Color Matte Blush (Deep Coral) - Blush yg pigmented dgn warna deep coral. Krn cukup pigmented, setelah mengambil isi produk, ketuk lembut brush trlebih dahulu sehingga tdk terlalu powdery dan warna yg dihasilkan lebih soft (tips ini berlaku jg utk pengaplikasian semua jenis produk yg bertekstur powder/pressedpowder)..🍁Wet n Wild Megaglo Highlighting Rose Gold Bar - Highlighter limited edition dgn warna orange-ish dan rona gold yg pas utk autumn-look. Bikin wajah makin kelihatan glowing..🍂 Lasting Finish Lipstick by Kate (shade no. 31) - it comes with super smooth texture and lightweight formula. It keep my lips soft and gives my lips a perfect finish.. So, itu tadi list produk yg Yuki pakai utk meng-create Autumn Makeup Inspiration ini. Pointnya ada pd riasan mata dgn gradasi eyeshadow brown-ish shimmer, orange-ish cheeks dan natural lipcolor....#autumnmakeup #fallmakeup #BeautyBlogger #BeautyVlogger #clozetteid  #BeautyBloggerID #Makeup #Cosmetics #Cosmetic #BeautyBloggerIndonesia #style #asian #Beauty #Cute #girls #makeup #Japanesemakeup #Kawaii

KAWAII AUTUMN MAKEUP (PART. II)'And all at once, Summer collapsed into fall' 🍂🍁. Hello... more

KAWAII AUTUMN MAKEUP (PART. II)'And all at once, Summer collapsed into fall' 🍂🍁. Hello... more
Siapa yang sumpek sama kulit kusam, bekas jerawat menghitam, pori-pori besar, whiteheads, blackheads dan jerawat? 2 minggu ini aku cobain @avoskinbeauty Miraculous Refining Toner yang hype itu. Produk ini sifatnya exfoliating toner tapi ramah banget di kulit sensitifku. Pengaplikasiannya bisa diusap pakai kapas atau dikompres ke jerawat.
.
Baru 2 minggu hasilnya udah mulai kelihatan loh. Kalian bisa lihat highlight "AVOSKIN TONER" di feed-ku untuk first impression/ mini review dan foto before after pemakaian selama 2 minggu.
.
Aku akan teruskan pemakaian sampai 1 bulan dan tulis review lengkapnya di blog-ku,
www.gadzotica.com. Nantikan updatenya ya.
.
Oya, sekarang Avoskin Official di Tokopedia lagi diskon loh. Best deal banget buat kalian yang pengen cobain produk-produknya. Untuk info lengkapnya langsung cus ke Tokped ya.
.
@sbybeautyblogger 
#avoskintonerreview #sbybeautyblogger #beautybloggerid #beautyinfluencer #productphotography #beauty #review #Clozetteid

Siapa yang sumpek sama kulit kusam, bekas jerawat menghitam, pori-pori besar, whiteheads,... more

Siapa yang sumpek sama kulit kusam, bekas jerawat menghitam, pori-pori besar, whiteheads,... more
KAWAII AUTUMN MAKEUP (PART. I)'And all at once, Summer collapsed into fall' 🍂🍁. Hello Autumn, long time no see! My favourite month of the year, daun warna-warni, style fashion kece yg didominasi oleh warm-tone, sprti pemilihan warna makeup inspiration kali ini yg jg didominasi oleh wrn brown-orange..First of all thankiss @kumurabeauty for the sweetest products to create this makeup look 💕 Let me write down a mini review about these products :.🍂 Lipsmacker Lipbalm - Dgn aroma icecream. Gemes bgt sm packagingnya! (Tips : sebelum pakai lipstick, aplikasikan lipbalm terlebih dahulu supaya bibir lembab. Biarkan beberapa saat br kemudian memakai lipproducts lainnya)..🍁 Beauty Creations The Sweetest Palette - This is the sweetest! Packagingnya lucu parah dgn gbr berbagai macam cake, candy. Warna2 eyeshadow palette ini didominasi oleh warna warm, mulai dari soft brown hingga dark brown, matte dan jg shimmer. Perfect for autumn-makeup! Nama masing2 shadenya jg unik dgn nama makanan seperti : Candy Apple, Jelly Bean, etc... 🍂 City Color Matte Blush (Deep Coral) - Blush yg pigmented dgn warna deep coral. Krn cukup pigmented, setelah mengambil isi produk, ketuk lembut brush trlebih dahulu sehingga tdk terlalu powdery dan warna yg dihasilkan lebih soft (tips ini berlaku jg utk pengaplikasian semua jenis produk yg bertekstur powder/pressedpowder)..🍁Wet n Wild Megaglo Highlighting Rose Gold Bar - Highlighter limited edition dgn warna orange-ish dan rona gold yg pas utk autumn-look. Bikin wajah makin kelihatan glowing..🍂 Lasting Finish Lipstick by Kate (shade no. 31) - it comes with super smooth texture and lightweight formula. It keep my lips soft and gives my lips a perfect finish.. So, itu tadi list produk yg Yuki pakai utk meng-create Autumn Makeup Inspiration ini. Pointnya ada pd riasan mata dgn gradasi eyeshadow brown-ish shimmer, orange-ish cheeks dan natural lipcolor...Stay tuned untuk part.II nya, Yuki upload malam ini 💋..#autumnmakeup #fallmakeup #BeautyBlogger #BeautyVlogger #clozetteid  #BeautyBloggerID #Makeup #Cosmetics #Cosmetic #BeautyBloggerIndonesia #style #asian #Beauty #Cute #girls #makeup #Japanesemakeup #Kawaii

KAWAII AUTUMN MAKEUP (PART. I)'And all at once, Summer collapsed into fall' 🍂🍁. Hello Autumn,... more

KAWAII AUTUMN MAKEUP (PART. I)'And all at once, Summer collapsed into fall' 🍂🍁. Hello Autumn,... more
Mini Review..Lipstick from @nakeupface . Their brand seems to prefer a glamour, trendy style that still has the core. KBeauty “minimal makeup look” . The Lipstick comes in a gold foiled box, which has a very simple design but a sleek look. The bullet is a large and square and has a gold metallic finish with the cap is glittery...This lipstick focus on two points their plumping effect and hydrating with silk finish shade #05 Stalker. This lipstick has a immediate menthol like cooling effect. The colour of the lipstick is very vibrant and the formula does apply very easily and smoothy (no patchiness even on reapplication) ..i’m using @nakeupface lipstick shade #05 Stalker..If you want to get this lipstick, it is selling on @summer.beautyhouse

Mini Review..Lipstick from @nakeupface . Their brand seems to prefer a glamour, trendy style that... more

Mini Review..Lipstick from @nakeupface . Their brand seems to prefer a glamour, trendy style that... more
MINI REVIEW: AVOSKIN NOURISHING EYECREAM
.
.
Salah satu best eyecream yang direkomendasikan oleh Affi Assegaf dan temen-temen di @femaledailynetwork . Teksturnya medium to thick, agak trick pakenya karen harus pake dikiiit banget di area bawah mata dan kelopak atas mata (bawah alis).
.
.
Tips ambil secuil eyecream ini pake jari manis kanan, trus dibagi ke jari manis kiri yang adil, biar gak berantem, gak cemburuan. Trus jari manisnya totol tiga kali di bawah mata atau bagian yang biasanya item/ada garis halus. Lalu baurkan dengan jari manis juga dengan lembut, jangan pake jempol kaki yes, riweuh 👌
.
.
Efek pemakaian sebulanan lebih ada di slide 2: yang mana bisa terlihat garis-garis tanda ((pendewasaan)) yang jadi lebih smooth. .
Repurchase? Yes, aku udah pakek 3 pot 👌 harga sekitar 149.000 , setara dengan 4 gelas kokumi.
.
Review lebih lengkap di www.meylisa.com

#fotdibb #bbloggerid #indobeautygram #clozetteid #fdbeauty #indobeautyblogger #indonesianbeautyblogger #BPers #Beautiesquad #bloggerceriaID #bloggerceria #bloggerperempuan #fotdibb #indonesianfemaleblogger #beautybloggerID #bblogger #bloggerjakarta #femalebeautyblogger #indonesianfemalebloggers #hijabblogger #hijabblog #bloggerhijab #hijabstyle #hijaboutfit #hijabclubindo 
@indobeautyblogger @bloggerperempuan @femalebloggersid @bloggerceriaid

MINI REVIEW: AVOSKIN NOURISHING EYECREAM . . Salah satu best eyecream yang direkomendasikan oleh... more

MINI REVIEW: AVOSKIN NOURISHING EYECREAM . . Salah satu best eyecream yang direkomendasikan oleh... more
Full face using Daiso makeup? Is it possible to create a complete and decent look with only Daiso makeup?

Well, i've tried them all for you and make mini reviews for each product that i used so next time you find yourself in Daiso, you'd know which product's safe to get and which you should run far... Far away from 😂. Swipe for the actual look (coz i already modify the products using other things for a better result in the first pic 😂) and go to : http://bit.ly/onebrandlookDaiso for details and the mini reviews!

#daiso #daisomakeup #onebrandlook #onebrandtutorial #fullfacedaisomakeup #review #daisomakeupreview 
#review 
#clozetteid #girl #asian
#sbybeautyblogger
#bloggerindonesia #bloggerceria #beautynesiamember #influencer #beautyinfluencer #indonesianbrand #indonesianmakeup #surabayablogger #SurabayaBeautyBlogger #bbloggerid #beautybloggerid #beautybloggerindonesia #surabayainfluencer #bloggerperempuan #indobeautysquad  #makeup #cheapmakeup #makeuplook

Full face using Daiso makeup? Is it possible to create a complete and decent look with only Daiso... more

Full face using Daiso makeup? Is it possible to create a complete and decent look with only Daiso... more
#KisahAraya Massage Oil @mustelaindonesia⠀⠀⠀⠀⠀⠀⠀⠀⠀———⠀⠀⠀⠀⠀⠀⠀⠀⠀Sesungguhnya ini udah jadi massage oil nya ibuk sih hahahah! Wangi nya enak, relaxing. Ada aroma floral nya menurut gue. Di kulit araya yg sensitive itu sih fine aja, tp sekarang araya gue pijet nya pake MKK jadinya Massage Oil ini beralih jadi milik ibuk 😛⠀⠀⠀⠀⠀⠀⠀⠀⠀———⠀⠀⠀⠀⠀⠀⠀⠀⠀Yg gue suka tuh oil ini enggak greasy, ya maybe karena kan sebenernya buat bayi jadi formula nya ringan. Enggak lengket juga, enakeun lah buat pijet. Udah pernah gue bikin sih mini review nya di blog, ya cus ke www.rayditaa.com terus search MUSTELA di search box nya. Oke oke, unch ❤️ #clozetteid #babymassage #pijatbayi #minyakpijat #massageoil #mustelaindonesia #babymassageoil

#KisahAraya Massage Oil... more

#KisahAraya Massage Oil... more
Caption : Heyyo geenggs, pasti udah sempet liat mini review aku tentang produk barunya @riveracosmetics kaan? 😁Sekarang mereka ngadain giveaway looh! Hadiahnya juga kece banget! 💕1. Samsung Galaxy Watch (42mm) for 1 lucky winner2. MAP voucher @ IDR 1.000.000 for 2 winners3. MAP voucher @IDR 400.000 for 2 winner And Rivera special hampers worth for IDR 400.000Cara ikutannya juga gampang bangeet! 1. Post make up look terbaikmu menggunakan Cover It All Foundation dan Luminous Micro Powder dari Rivera di feed . Temanya bebas! Bisa make up untuk ke kantor, ke pesta, atau jalan-jalan santai saat weekend. Describe hows you are so confident with them.. 2. Tag @Riveracosmetics dan tag 3 orang teman kamu.3. Follow Instagram @Riveracosmetics4. Pastikan akunmu tidak di-private agar bisa dilihat oleh tim Rivera5. Sertakan hastag #CrazyLongHoursFoundation #WeAreRiverans #LiveLifeEmpowered #RiveraChallengeGiveawaynya berakhir tgl 15 November 2019 dan pengumuman pemenangnya tgl 25 November 2019. Rivera: Light Up Your Day. Find Your Best Look 😘#widlimselfie #Clozetteid

Caption : Heyyo geenggs, pasti udah sempet liat mini review aku tentang produk barunya... more

Caption : Heyyo geenggs, pasti udah sempet liat mini review aku tentang produk barunya... more
Menemukan sampo yang cocok untuk rambut berhijabku ternyata bisa membuatku sebahagia ini ya!! Jujur dari lubuk hatiku yang paling dalam, selama ini susaaaaah banget nemu sampo yang cocok untuk rambut berhijab, ada aja deh alasan yang bikin nggak cocoknya. Sampe akhirnya aku ketemu Rejoice Shampoo 3in1 Perfect Cool ini yang bener-bener bisa bikin aku jatuh hati dari sejak pertama kali. Udah kayak ketemu jodoh aja ya? *eh.Kayaknya lumayan lebay ya aku kalo cerita? Haha... Klik link di bio untuk mengetahui kelebayanku seutuhnya, hahahaha.....@rejoice.id @beautynesia.id#rejoice #rejoiceid #rejoiceshampoo #rejoiceperfectcool #hijabshampoo #shampoo #kesempurnaanberhijab #rejoicehijabperfection #sesejukhijrahmu #hijab #hijabers #shampoohijab #clozetteid #haircare #review #minireview #blogger #mantrianarani

Menemukan sampo yang cocok untuk rambut berhijabku ternyata bisa membuatku sebahagia ini ya!! Jujur... more

Menemukan sampo yang cocok untuk rambut berhijabku ternyata bisa membuatku sebahagia ini ya!! Jujur... more
Halo sunshine!Kali ini aku punya mini review tentang salah satu skincare asal jepang yang fokus pada menutrisi dan mencerahkan untuk berbagai jenis kulit. Tersertifikasi Halal Japan Islamic Trust (JIT) dengan packaging produk yang nggak kalah menariknya. Mau tauuu siapa diaa?Silahkan Klik link di profil akuu atauuu keee :https://youtu.be/bxngdnzlQ7ESelamat Nonton!#Clozetteid #Clozetteidreview #MomohimeXClozetteIDReview #momohime #halalskincare #japanskincare @clozetteid  @momohime_indonesia_official

Halo sunshine!Kali ini aku punya mini review tentang salah satu skincare asal jepang yang fokus... more

Halo sunshine!Kali ini aku punya mini review tentang salah satu skincare asal jepang yang fokus... more
Definisi kulit Shining, Shimmering, Splendid 🎶✨👸🏻 Can you so that glow? All thanks to @mediheal_idn sheet mask that do the magic! 😆 Jadi beberapa waktu lalu aku dateng ke @sociolla store di Lippo Mall Puri dan melakukan skin check untuk tau varian Mediheal mana yang paling tepat untuk kulitku. Thankfully, kadar moisture dan oil ku balance tapi butuh healing acne & inflammation di beberapa area wajah, akhirnya aku coba varian Tea Tree  Care Solution Essential Mask EX and loving the result afterwards~ 
The essence is not sticky at all and I can feel my skin become so smooth, plump, and refreshed. Yes, produk ini bisa ngebantu untuk mengurangi redness di wajahku dan jerawat yang baru muncul langsung matang keesokan harinya. Let’s see apakah bisa mengurangi noda jerawat setelah beberapa kali pemakaian 💖 Anyway, since I love this product, kira-kira pada tertarik ngga kalo aku bikin giveaway masker Mediheal? 😗 
And last but not least, thank you @sociolla for Mediheal Beauty Experience “Reveal Your Own Beauty” and gonna give a big shoutout to @sweet.escape for capturing my glow moment on that big screen! ✨
.
.
.
.
.
#RealMeRealSkin #Mediheal #MedihealIndonesia #GhinaMiniReview #beauty #skincare #makeup  #beautybloggerindonesia #beautyinfluencer #beautyenthusiast #beautytips #clozetteid #skincarejunkie #beautyreview #얼짱 #일상 #데일리룩 #셀스타그램 #셀카

Definisi kulit Shining, Shimmering, Splendid 🎶✨👸🏻 Can you so that glow? All thanks to... more

Definisi kulit Shining, Shimmering, Splendid 🎶✨👸🏻 Can you so that glow? All thanks to... more
I'm so into skincare with probiotics since i've tried @soonplus_official 5.5 Cleansing Foam! So today i'll share my mini review on SOON+ 5.5 Balancing Emulsion. The key ingredients are Probiotics Water (to maintain healthy skin barrier), Allantoin (powerfully moisturizing ingredient), and Red Berry Peptide (for skin soothing).
Lets get it started!
.
PACKAGING - Thick plastic bottle with the same colour (nude beige) as the other product of SOON+. At first i thought the cap should be twisted to open but i'm wrong 🤣 it could be opened and closed very easily, but still feels tight and secure. It comes with a pump and you don't have to worry, it won't spilled easily 😆
.
TEXTURE - Since this is an emulsion, you could fit this product on your skincare regime after toner and before serums. A little bit thick, lotion-like texture but not sticky at all. It absorbs rather quick on my skin. Feels light and not greasy 👍 I love light texture like this.
.
FRAGRANCE - This is fragrance-less, which i love. Great for layering skincare because too much different fragrance could be very annoying to me.
.
AFTERMATH - It provides enough moisture for my normal to dry skin even with its light texture. Quickly absorbs & no sticky feeling after application. My skin also feels more supple & soft! I love how the weak acidic formula within this product improves my skin barrier condition so i rarely got flaky and dry patches around my jawline again.
.
SOON+ 5.5 line are amazing and do the job very well on my normal to dry skin. Wish i could try more of their products 😍
Buy this product on my Charis Shop -
https://hicharis.net/annisapertiwi/r2V 👌
.
#5.5BALANCINGEMULSION #5.5 #EMULSION #SOONPLUS #SOON+ #BALANCINGEMULSION #SKINCARE #KBEAUTY #BEAUTY #CHARIS #CHARISSTORE #charisAPP #charisceleb @hicharis_official @charis_celeb
#vsco #clozetteid #skincarereview #kbeauty #kbeautyenthusiast #kbeautyjunkie #beautyenthusiast #beautyenthusiastindonesia #skincarejunkie #skincareenthusiast

I'm so into skincare with probiotics since i've tried @soonplus_official 5.5 Cleansing Foam! So... more

I'm so into skincare with probiotics since i've tried @soonplus_official 5.5 Cleansing Foam! So... more
So this is my current #amroutine nowadays to improve hydration and keep moisturize all day long. Three of them already reviewed in my blog amd youtube channel which you can find the link on my bio.

Tomorrow if possible, I will share the mini review of @skinaquaid sunscreen in Instagram first, schedule for blog within next week. Yay or nay? 🤭

Are you interested with one of them to be yours? What and why?

#skincare #skincarecommunity #skincarejunkie #skincareaddict #skincarelover #skincareritual #kbeauty #koreanbeautyproduct #kbeautyunicorns #kbeautyblogger #koreanskincare #kbeautycommunity #abcommunity #asianskincare #abskincare #abbeatthealgorithm #discoverunder5k #rasianbeauty #beautyflatlay #beautyfavorites #skincareblogger #skincareroutine #idskincarecommunity #clozetteid

So this is my current #amroutine nowadays to improve hydration and keep moisturize all day long.... more

So this is my current #amroutine nowadays to improve hydration and keep moisturize all day long.... more
Jadi udah semingguan ini aku nyobain pake @nurishorganiq dan mau mini review 💞🌸 Brightening Foamy Cleanser: ini aku suka, karna busanya banyak & gak bikin kulit kerasa kering🌸 Brightening Toner: ini nyegerin kulit banget dan gampang banget nyerep nya🌸 Brightening Day Cream SPF20: tekstur nya ringan, lumayan ngelembapin & gak bikin greasy🌸 Brightening Micellar Water: lumayan buat ngangkat makeup ringan & gak bikin kulit keringOverall, aku lumayan suka sama produk nya. Aku harus pake lebih lama lagi supaya efek brightening nya berasa, tapi so far bagus sih. Dan kemasannya unyu banget & travel friendly 💖  #NurishOrganiqIDReview #RadiateYourTrueNature #ClozetteID#minireviewbygiselav

Jadi udah semingguan ini aku nyobain pake @nurishorganiq dan mau mini review 💞🌸 Brightening... more

Jadi udah semingguan ini aku nyobain pake @nurishorganiq dan mau mini review 💞🌸 Brightening... more
✨Mini Review #SomethincSerum
Brand ini punya Indonesia asli alias lokal. Emang brand yang belum lama sih, dia terkenal karena lunya 3 serum. Salah satunya Niacinamide ini. Karena kulitku lagi banyak banget bekas jerawatnya, akhirnya aku memutuskan mencoba. Toh waktu di #jxb harganya mursida banget!
⠀⠀
Sekarang serumnya udh habis satu botol dan aku lg pake botol kedua. Berikut review singkat dari aku mengenai @somethincofficial
⠀⠀
Love:
- kemasannya kecil, jadi enak dibawa kemana-mana
- tekstur serumnya ringan, cair tapi agak licin ada gliserinnya gitu.
- cepat menyerap
- cruelty free dan sudah halal
- harganya super terjangkau
- hasilnya nyata. Tapi ga instan ya, ga ada skincare yg instan. Kalo ada patut dipertanyakan keamanannya🤣
⠀⠀
Tapi, tentunya ada minusnya dr produk ini:
- engga minus sih, tapi akan lebih baik kalau bisa masuk drugstore💃🏽
⠀⠀
Kesimpulan:
Menurutku, produk ini sesuai kali sama claimnya yang bisa mencerahkan wajah + memudarkan bekas jerawat. Produk ini juga klaim bisa melembabkan wajah, tp buat ku tidak mengunci kelembapan sampai waktu yg lama.
⠀⠀
Harga: 115.500
⠀⠀
Rate: ⭐️⭐️⭐️⭐️
⠀⠀ #ClozetteID #beauty #skincare #makeup #beautybloggerindonesia #indobeautysquad #beautybloggerceriaid #beautiesquad #indobeautygram #beautyblogger #somethinc #somethincsquad #minireview #facewash #facialwash #ipreview via @preview.app

✨Mini Review #SomethincSerum Brand ini punya Indonesia asli alias lokal. Emang brand yang belum... more

✨Mini Review #SomethincSerum Brand ini punya Indonesia asli alias lokal. Emang brand yang belum... more
[MAKE UP REVIEW]
.
Kalo ditanya lebih suka skin care atau make up, jawabannya udah pasti skin care. Tapi tetep aja kadang suka pengen pake make up juga walau lebih ke make up minimalis aja sih. Aku lebih suka pake BB/CC Cream dibanding foundation. Karena rasanya lebih ringan (walau kata orang justru lebih ringan foundation, gak tau deh gak terlalu ngerti), coveragenya cukup yang medium aja, dan yang pasti ringan dikulit.
.
Aku pake BB Cream dari @maybelline Super BB Cream Fresh Matte (shade : natural), dan CC Cream dari @zoyacosmetics (shade : sand). Pakenya gonta-ganti aja tergantung mood. Keduanya sama-sama cocok dikulit aku dan yang pasti ringan. BB Cream punyanya Maybelline finishnya matte dan ada sensasi sejuk waktu diaplikasikan, tapi pori-pori besarku masih keliatan. Sementara CC Cream punyanya Zoya Cosmetics finishnya agak dewy di aku, untuk kulit berminyak sepertiku harus pake bedak lagi, tapi pori-pori besarku ketutup dong kalo pake ini.
.
.
#clozetteid #bbcream #cccream #maybellinebbcream #zoyacosmeticscccream #maybelline #zoyacosmetics  #makeup #makeupreview #minireview #bukanmakeupbattle #mantrianarani #blogger

[MAKE UP REVIEW] . Kalo ditanya lebih suka skin care atau make up, jawabannya udah pasti skin care.... more

[MAKE UP REVIEW] . Kalo ditanya lebih suka skin care atau make up, jawabannya udah pasti skin care.... more
Gengs, kalian suka kelupaan pake sunscreen gak? Tiba2 udah pake primer dan foundation ajaa 🤣Aku kadang kelupaan soalnya, makanya aku bikin tips memakai sunscreen di atas makeup. Salah satu nya adalah pakai sunscreen berbentuk spray seperti @snpofficial.id Sun Spray ini 💕Tips lengkapnya (dan juga mini review produk ini) cek aja di blog aku yaa, klik link di bio aku 😘P.s : daripada gak pake sunscreen sama sekali, mending pakai walau mungkin cuma nempel dikit 🙈 NEVER skip sunscreen yaa 💕#clozetteid #widlimskincare

Gengs, kalian suka kelupaan pake sunscreen gak? Tiba2 udah pake primer dan foundation ajaa 🤣Aku... more

Gengs, kalian suka kelupaan pake sunscreen gak? Tiba2 udah pake primer dan foundation ajaa 🤣Aku... more
[MAKE UP REVIEW]
.
Kalo ditanya lebih suka skin care atau make up, jawabannya udah pasti skin care. Tapi tetep aja kadang suka pengen pake make up juga walau lebih ke make up minimalis aja sih. Aku lebih suka pake BB/CC Cream dibanding foundation. Karena rasanya lebih ringan (walau kata orang justru lebih ringan foundation, gak tau deh gak terlalu ngerti), coveragenya cukup yang medium aja, dan yang pasti ringan dikulit.
.
Aku pake BB Cream dari @maybelline Super BB Cream Fresh Matte (shade : natural), dan CC Cream dari @zoyacosmetics (shade : sand). Pakenya gonta-ganti aja tergantung mood. Keduanya sama-sama cocok dikulit aku dan yang pasti ringan. BB Cream punyanya Maybelline finishnya matte dan ada sensasi sejuk waktu diaplikasikan, tapi pori-pori besarku masih keliatan. Sementara CC Cream punyanya Zoya Cosmetics finishnya agak dewy di aku, untuk kulit berminyak sepertiku harus pake bedak lagi, tapi pori-pori besarku ketutup dong kalo pake ini.
.
.
#clozetteid #bbcream #cccream #maybellinebbcream #zoyacosmeticscccream #maybelline #zoyacosmetics  #makeup #makeupreview #minireview #bukanmakeupbattle #mantrianarani #blogger

[MAKE UP REVIEW] . Kalo ditanya lebih suka skin care atau make up, jawabannya udah pasti skin care.... more

[MAKE UP REVIEW] . Kalo ditanya lebih suka skin care atau make up, jawabannya udah pasti skin care.... more
✨Mini Review #SimpleSkincare
Brand ini termasuk baru masuk Indonesia, pas aku compare di KL sama Indo murahan di sini. Katanya brand ini terkenal banget diluar. Bahkan, Katleen Light suka banget sama cleansing wipesnya. Karena aku emang lagi butuh sabun cuci muka dan bosen utk balik lg ke Hada Labo, jadi, aku coba sabun cuci mukanya @simpleskin yang versi gel ini.

Love:
- aku suka banget karena sabun ini sama sekali ga mengandung SLS/SLES jadi busanya seminim itu
- bener-bener engga bikin kulit kering apalagi ketarik
- engga ada aroma, light sekali juga teksturnya
- harganya super terjangkau
- ngebersihin muka dengan maksimal👍🏼 Tapi, tentunya ada minusnya dr produk ini:
- saking ga berasa kering, pas pake ini kulit rasanya licin (kayak ga habis cuci muka) mungkin beberapa orang ga akan suka rasa ini sih.

Kesimpulan:
Menurutku aih, produk ini sesuai kali sama claimnya. Cocok buat kulit kering sensitif, aman, karena kandungannya safe. 
Harga: -/+ 40k

Rate: ⭐️⭐️⭐️⭐️ #ClozetteID #beauty #skincare #makeup #beautybloggerindonesia #indobeautysquad #beautybloggerceriaid #beautiesquad #indobeautygram #beautyblogger #simpleskin #minireview #simpleskincare #facewash #facialwash

✨Mini Review #SimpleSkincare Brand ini termasuk baru masuk Indonesia, pas aku compare di KL sama... more

✨Mini Review #SimpleSkincare Brand ini termasuk baru masuk Indonesia, pas aku compare di KL sama... more
Baru nyobain produk-produknya @naavagreencosmetics, nih. Ada lip cream matte, eye shadow, blush on, bb cushion, face wash, sama micellar water.Ada yang pernah kamu coba juga nggak?Baca mini review produk-produknya & lihat detail makeupnya di blog yuk, langsung klik link yang ada di bio atau ke www.akpertiwi.com 🌞#BVYXNaavagreen #BeautySharingWithBVY#vsco #clozetteid #beautyenthusiastindonesia #beautyenthusiast #beautyblogger #beautybloggerindonesia #review #makeup #naavagreen

Baru nyobain produk-produknya @naavagreencosmetics, nih. Ada lip cream matte, eye shadow, blush on,... more

Baru nyobain produk-produknya @naavagreencosmetics, nih. Ada lip cream matte, eye shadow, blush on,... more
Hello everyone! Jadi beberapa minggu yang lalu aku dikirimin skincare dari @mixdaircosmeticstore @mixdair_indonesia 💕.And here's my Mini Review 🌼 Mixdair Hyaluronic Acid Serum : Klaim melembabkan dan menghaluskan kulit yang kasar, mencerahkan kulit dan mengecilkan pori-pori ~~ Menurutku serumnya lumayan sih, teksturnya cair, warnanya bening, gak ada bau dan cepat meresap .. sayangnya agak lengket dikulit 😌 Sampai sekarang gak menimbulkan reaksi negatif dikulitku🌼 Vibrant Glamour Fullerene Dehydrated Mask Pack : Klaim memberi nutrisi pada kulit, memperbaiki dan merawat kulit yang rusak, meningkatkan elastisitas kulit, mengencangkan dan menghaluskan kulit ~~ Awal cobain masker ini aku bingung kok maskernya kering .. ternyata harus ditambahin 'pure water' dulu untuk merendam maskernya supaya maskernya basah 😊 Menurutku lembaran maskernya agak lebar, tipis dan sedikit susah untuk dibentuk 😂 tapi aku suka sama hasilnya yang bikin kulitku terasa lebih fresh dan kenyal🌼 Mixdair BB Beauty Skin : Teksturnya ringan, gampang diblend dengan coverage yang medium .. warnanya pas dikulitku dan lumayan tahan lama juga, gak bikin kulitku makin berminyak 😊..Overall aku suka sama produknya ^^ selain harganya yang sangat murah, produk ini juga gak bikin kulitku breakout atau jerawatan .. tapi balik lagi ke kalian berani mencoba atau tidak 😊❤️....Tags : #mixdair #mixdaircosmetic #vibrantglamour #tampilcantik #cantikekonomis #zonamakeupid #makeupnatural #inspirasicantikmu #tipskecantikan #belajarmakeup #ragamkecantikan #zonacantikwanita #makeupvideos #igvbeauty #makeupindonesia #tutorialmakeupindo #ootdhijabers #hijabers #indoneautysquad #beautyvloggerindonesia #yukmakincantik #cantikhariini #100daysofmakeup #100daysofmakeupchallenge #makassarbeautygram #makassarbeauty #skincarelover #clozetteid

Hello everyone! Jadi beberapa minggu yang lalu aku dikirimin skincare dari @mixdaircosmeticstore... more

Hello everyone! Jadi beberapa minggu yang lalu aku dikirimin skincare dari @mixdaircosmeticstore... more
Seperti yang udah kelen tau kalo beberapa hari yang lalu aku sempat share mini review Vaseline Super Food Skin Serum varian Citrus & Green Tea di Instagramku.Dan kali ini aku buatkan review lengkapnya diblogku, buat yang penasaran bisa klik link blog on my bio atau bisa kunjungi www.coolatmoshpeer.com ya 😉 😊#VaselineSuperFoodSkinSerum#bodylotion#bodyserum#bodyskincare#beautyjournal#clozetteid#qupas#lemonsquad#bblogger#bloggirlsid#ihbpositivity#beautybloggerindonesia#bloggercommunity#beautyhijabers#바디로션#바디로션추천#화장품#스킨케어#데일리#일상#뷰티#뷰티그램#뷰티블로거#뷰티스타그램

Seperti yang udah kelen tau kalo beberapa hari yang lalu aku sempat share mini review Vaseline... more

Seperti yang udah kelen tau kalo beberapa hari yang lalu aku sempat share mini review Vaseline... more
How to be a Japanese Shoujo🌸💮🌸:
1. Wear yukata☑️
2. Igari makeup on face☑️
.
.
Oh iya tutorial #igarimakeup versi ku ini udah aku publish di blogspot ku loh📝! Selain simple😻, khusus pada tutorial ini, aku juga buat dalam bentuk video dan menulis mini review dari produk-produk yang aku gunakan pada makeup ini💄. So tunggu apa lagi beaties? Yuk buruan mampir ke blog ku😘!
.
.
#ゆかた
#かわいい
#quotesaboutlife 
#きれい #しょうじょ #キュート #ビューティープロコンテスト #ブロガー #クォーツ #イガリシノブ
#bloggermaniac #bloggerlife #bloggermafia #japanesemakeup #cosplay #makeup #makeuplooks #simplemakeuplook #igarimakeup #clozetteid #kawaiibeautyjapan #makeuptutorial #tutorial

How to be a Japanese Shoujo🌸💮🌸: 1. Wear yukata☑️ 2. Igari makeup on face☑️ . . Oh... more

How to be a Japanese Shoujo🌸💮🌸: 1. Wear yukata☑️ 2. Igari makeup on face☑️ . . Oh... more
Good morning moms! 💋 Happy monday, selamat beraktifitas kembali, setelah 2 hari libur yaa kan, mager pasti bawaannya, biar semangat jangan lupa pakai lipstik 💄
.
Aku lg suka sama lipcreamnya @pixycosmetics nih yg shade Mild Peach, cantik necurel gimanaa gitu, hahaa. Tapi serius, kualitas brand lokal sekarang emang makin kece, si pixy ini teksturnya jg creamy, aplikatornya enak, dan harganya nyaman dikantong emak 😂
.
Dah'ah sekilas infonya, mak mau nyayur dulu. Btw, foto depan pintu pake cahaya illahi cakeps jg 🤣
.
.
.
#JessieMiniReview #reviewlipcream #lipcream #beauty #bloggers #beautybloggers #clozetteid #makeup #qupas #pixylipcreammatte

Good morning moms! 💋 Happy monday, selamat beraktifitas kembali, setelah 2 hari libur yaa kan,... more

Good morning moms! 💋 Happy monday, selamat beraktifitas kembali, setelah 2 hari libur yaa kan,... more
Yeah, I got you ! 🙈
-
Finally, aku bisa cobain @23yearsold_official Badecasil P-Original moisturizer ! Ini adl moisturizer kedua yg aku rekomenin ke kalian !
-
What’s good?
8 in 1 solution :
Non comedogenic, problematic skin care, skin calming, skin moisturizer, oil management, pore care, skin polisher and dead skin remover — kapan lg ada moisturizer yg selengkap ini coba.

Texture? Creamy tp ga lengket sama sekali krn kandungan airnya tinggi dan cpt bgt buat serap ke dlm kulit. Trs ada rasa segernya wkt d pake krn ada kandungan alkoholnya. Ini aman sih buat dry skin juga, krn ga buat kulit kering dan alkohol jg yg buat texturenya ga lengket 💯

Aku sdh 2 mingguan ini pake dan skin aku approved 👏🏻 ga ada purging sm sekali dan oil baru keluar d muka stelah 4jam’an lebih lah. Itu yg sampe bener” keliat sih. Kalo d bawah itu keliatan natural glow aja. Kulit jg jd kenyal, make up keliatan alus juga 🙈
-
I RATE IT 5/5 !
Suitable for all skin type.

Want to try?
Buy it on my @charis_celeb shop :

http://hicharis.net/tephieteph/gfF

Get special discount here 😛
Need mini review again? Stay tune on my IG story 🍃
.
.
.
#clozetteid 
#23yearsold 
#23yearsoldskincare 
#badecasil 
#badecasilcream 
#charis 
#hicharis 
#hicharis_official 
#charisceleb 
#skincare 
#sensitiveskincare 
#moisturizer 
#bestmoisturizer 
#tephcollaboration 
#bloggersurabaya 
#bloggerjakarta

Yeah, I got you ! 🙈 - Finally, aku bisa cobain @23yearsold_official Badecasil P-Original... more

Yeah, I got you ! 🙈 - Finally, aku bisa cobain @23yearsold_official Badecasil P-Original... more
Deodoran kesayangan dari @goodvibesbotanical. Deodoran yang bukan antiperspirant jadi akan tetap bikin kamu berkeringat seperti biasa.

Kalo kamu biasa pakai deodoran yang mengandung antiperspirant, awal-awal pake deodoran organic biasanya keringat kamu jadi lebih bau dari biasanya. Soalnya keringat yang keluar akan bercampur dengan residu antiperspirant yang nempel di ketiak kamu. Kalau kamu cuma pakai deodoran biasa kaya saya, detoks residunya sih gak terlalu parah.

Keringat itu sehat kok, kan ngeluarin racun dari tubuh. Cuma kan males ya kalau keringat ketemu bakteri, jadinya bauk! Deodoran #Goodvibes ini mengandung bentonite clay dan tea tree oil yang bisa melawan bau tidak sedap.

Setelah pake deodoran GoodVibes ini kayaknya saya udah jarang pake deodoran pabrikan, sesekali aja kalo kepepet cuma itu adanya. Malah ke sini-sini seringkali gak pake deodoran karena merasa ketiak saya baik-baik aja.

Satu tube GoodVibes Natural deodorant ini isinya 16 gram, harganya IDR 85,000. Iya, lumayan mahal dibandingkan deodoran di supermarket, tapi bisa dipastikan organic certified dan ecocert approved. Cocok buat kamu yang kulitnya sensitif atau gak pengen banyak terpapar produk kimia sintetis.

Btw, ini kemasan lama. Belum sempat jajan produk-produk barunya GoodVibes lagi karena masih ngabisin stok di rumah. .
.
.

#MiniReview #MiniReviewAjeng #beauty #health #organicskincare #skincare #skincareindonesia #skincareorganik #skincareorganikindonesia #clozette #clozetteID #komunitasorganikindonesia #healthcare #bodycare

Deodoran kesayangan dari @goodvibesbotanical. Deodoran yang bukan antiperspirant jadi akan tetap... more

Deodoran kesayangan dari @goodvibesbotanical. Deodoran yang bukan antiperspirant jadi akan tetap... more
[Favorite] Say hi to my favorite toner atm: @a.stop2man Clear Face & Body Toner 🤗 Untuk yang mageran pasti suka deh sama toner yang bentuknya spray gini, apa cuma aku doang? 😅 Biasanya aku langsung semprotin ini ke muka (swipe to see). Spraynya lumayan langsung menyebar dan cukup 4-5 spray sih, tapi kalau mau pake kapas juga bisa kok. Jadi si toner ini bisa dipake untuk wajah dan seluruh badan, kan biasanya punggung sama bagian dada juga suka ada jerawatnya tuh. You should try this, semprotannya bisa muter 360 derajat, jadi bisa dipake untuk semprot langsung ke punggung 👌🏻 Toner ini mengandung AHA yang bisa mengangkat kulit mati, jadinya kulit jadi nggak kusam. Menurutku ini cukup gentle untuk dipake tiap hari, karena di aku ga ada iritasi gitu. Mukaku juga jadi jarang merah-merah atau jerawatan lagi, makanya cinta banget 😭 Dia juga ada soothing effect dan antibacterialnya, kalo untuk efek ke komedo/ pori-pori sih aku ga ngerasain apa-apa sih 🤔Btw, ini bisa dibeli di @hicharis_official shop aku dan guess what! Hari ini diskon 50% jadi cuma 149ribu 😭😭 Visit link ini http://hicharis.net/japobs/qtJ untuk beli yaaa (aku bakal taro di bio juga) 💖 #AStopClearToner #CharisCeleb @charis_celeb #charis #charisapp #charisstore #skincareroutine...#spraytoner #clozetteid #skincareaddict #minireview #acneprone #acneproneskin #ahatoner #beautybloggerindonesia #bloggerperempuan #koreanskincare #glowingskin #뷰티 #뷰티스타그램 #에이스톱 #미스트토너 #스킨케어

[Favorite] Say hi to my favorite toner atm: @a.stop2man Clear Face & Body Toner 🤗 Untuk yang... more

[Favorite] Say hi to my favorite toner atm: @a.stop2man Clear Face & Body Toner 🤗 Untuk yang... more